| Edit |   |
|---|
| Product Name | West Nile Virus Pre-M Recombinant Protein |
|---|
| Description | Purity >95% (by SDS-PAGE). Description: The E Coli derived 20 kDa recombinant protein contains the West-Nile N-terminal Pre-M Virus immunodominant regions (MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTIT YECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTH GESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE). The protein is fused with 6x His tag at C-terminal.Introduction: West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic compl |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), ELISA (EIA) |
|---|
| Other Names | [West Nile Virus Pre-M Recombinant Protein] |
|---|
| Gene, Accession, CAS # | [West Nile Virus Pre-M Recombinant Protein ] |
|---|
| Catalog # | MBS434131 |
|---|
| Price | |
|---|
| Order / More Info | West Nile Virus Pre-M Recombinant Protein from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|