| Edit |   |
|---|
| Antigenic Specificity | Neurexophilin 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Neurexophilin 3 antibody. Specificity: Neurexophilin 3 antibody was raised against the N terminal of NXPH3 |
|---|
| Immunogen | Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN |
|---|
| Other Names | neurexophilin-3; Neurexophilin-3; neurexophilin-3; neurexophilin 3, NXPH3; NXPH3; NPH3; KIAA1159; NPH3 |
|---|
| Gene, Accession # | Gene ID: 11248, NCBI: NP_009156.2 |
|---|
| Catalog # | MBS5302016 |
|---|
| Price | |
|---|
| Order / More Info | Neurexophilin 3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|