| Edit |   |
|---|
| Antigenic Specificity | Neurexophilin 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Neurexophilin 4 antibody. Specificity: Neurexophilin 4 antibody was raised against the N terminal of NXPH4 |
|---|
| Immunogen | Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL |
|---|
| Other Names | neurexophilin-4; Neurexophilin-4; neurexophilin-4; neurexophilin 4, NXPH4; NXPH4; NPH4; NPH4 |
|---|
| Gene, Accession # | Gene ID: 11247, NCBI: NP_009155.1 |
|---|
| Catalog # | MBS5300164 |
|---|
| Price | |
|---|
| Order / More Info | Neurexophilin 4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|