| Edit |   |
|---|
| Antigenic Specificity | PAM16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 94%, rat 94%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human PAM16 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
|---|
| Other Names | presequence translocase-associated motor 16 homolog (S. cerevisiae), Magmas, Tim16, TIMM16 |
|---|
| Gene, Accession # | Gene ID: 51025, UniProt: Q9Y3D7, ENSG00000217930 |
|---|
| Catalog # | HPA062721 |
|---|
| Price | |
|---|
| Order / More Info | PAM16 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|