Edit |   |
Antigenic Specificity | NUCKS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 100%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human NUCKS1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG |
Other Names | nuclear casein kinase and cyclin-dependent kinase substrate 1, NUCKS |
Gene, Accession # | Gene ID: 64710, UniProt: Q9H1E3, ENSG00000069275 |
Catalog # | HPA062351 |
Price | |
Order / More Info | NUCKS1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |