| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Protein, Autoantigenic (HnRNP-Associated with Lethal Yellow Homolog (Mouse)) (RALY) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family. |
|---|
| Immunogen | RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
|---|
| Other Names | AI663842|Merc|HNRPCL2|P542|zgc:103445 |
|---|
| Gene, Accession # | Gene ID: 22913 |
|---|
| Catalog # | ABIN630644 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Protein, Autoantigenic (HnRNP-Associated with Lethal Yellow Homolog (Mouse)) (RALY) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|