Edit |   |
Antigenic Specificity | TIFAB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 69%, rat 69%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human TIFAB polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ |
Other Names | TRAF-interacting protein with forkhead-associated domain, family member B |
Gene, Accession # | Gene ID: 497189, UniProt: Q6ZNK6, ENSG00000255833 |
Catalog # | HPA049372 |
Price | |
Order / More Info | TIFAB Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |