| Edit |   |
|---|
| Antigenic Specificity | NRCAM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NRCAM antibody. Specificity: NRCAM antibody was raised against the N terminal of NRCAM |
|---|
| Immunogen | NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP |
|---|
| Other Names | NRCAM; NRCAM; Neuronal Cell Adhesion Molecule; MGC138846; MGC138845; KIAA0343, |
|---|
| Gene, Accession # | NRCAM |
|---|
| Catalog # | MBS838870 |
|---|
| Price | |
|---|
| Order / More Info | NRCAM Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|