Edit |   |
Antigenic Specificity | Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. |
Immunogen | GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW |
Other Names | CG8893|Dmel\\CG8893|GA3PDH|GADPH|GAP|GAPDH|GAPDH II|GAPDH2|Gapd|Gapdh|Gapdh-2|Gapdh13F|GAPD|g3pd|gapd|GB14798|GAPC-2|GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2|T6J4.17|T6J4_17|glyceraldehyde-3-phosphate dehydrogenase C2|BEST:GH12586|CG12055|Dmel\\CG12055|GAPDH I|GAPDH-1|GAPDH1|GAPDHI|Gapdh-1|Gapdh43E|gadph|gapdh|gapdh-1|gh12586|KNC-NDS6|G3PD|cb609|mg:bb02e05|wu:fb33a10|wu:ft80f05|G3PDH |
Gene, Accession # | Gene ID: 2597,403755 |
Catalog # | ABIN630723 |
Price | |
Order / More Info | Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | PubMed: 21497116, 20709073 |