| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IKK gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-IKK gamma Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids. |
|---|
| Other Names | NF-kappa-B essential modulator isoform b; NF-kappa-B essential modulator; NF-kappa-B essential modulator; inhibitor of nuclear factor kappa B kinase subunit gamma; FIP-3; IkB kinase-associated protein 1; IKKAP1; Inhibitor of nuclear factor kappa-B kinase subunit gamma; I-kappa-B kinase subunit gamma; IKK-gamma; IKKG; IkB kinase subunit gamma; NF-kappa-B essential modifier, IKBKG; IKBKG; IP; IP1; IP2; FIP3; IKKG; IPD2; NEMO; FIP-3; Fip3p; IMD33; AMCBX1; IKKAP1; ZC2HC9; IKK-gamma; FIP3; NEMO; NEMO |
|---|
| Gene, Accession # | IKBKG, Gene ID: 8517, NCBI: NP_001093326.2, UniProt: Q9Y6K9 |
|---|
| Catalog # | MBS178627 |
|---|
| Price | |
|---|
| Order / More Info | IKK gamma Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Rothwarf, D. M., Zandi, E., Natoli, G., Karin, M.IKK-gamma is an essential regulatory subunit of the I-kappa-B kinase complex.Nature 395: 297-300, 1998. 2. Yamaoka, S., Courtois, G., Bessia, C., Whiteside, S. T., Weil, R., Agou, F., Kirk, H. E., Kay, R. J., Israel, A.Complementation cloning of NEMO, a component of the I-kappa-B kinase complex essential for NF-kappa-B activation.Cell 93: 1231-1240, 1998. |
|---|
| 产品资料 |
|
|