| Edit |   |
|---|
| Antigenic Specificity | Carbonyl Reductase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Carbonyl Reductase 1 antibody. Specificity: Carbonyl Reductase 1 antibody was raised against the C terminal of CBR1 |
|---|
| Immunogen | Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
|---|
| Other Names | carbonyl reductase 1; Carbonyl reductase NADPH 1; carbonyl reductase NADPH 1; carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase NADP(+) (EC:1.1.1.197); NADPH-dependent carbonyl reductase 1; Prostaglandin 9-ketoreductase; Prostaglandin-E(2) 9-reductase (EC:1.1.1.189); Short chain dehydrogenase/reductase family 21C member 1, CBR1; CBR1; CBR; hCBR1; SDR21C1; CBR; CRN; SDR21C1 |
|---|
| Gene, Accession # | Gene ID: 873, NCBI: BAA89424.1 |
|---|
| Catalog # | MBS5302605 |
|---|
| Price | |
|---|
| Order / More Info | Carbonyl Reductase 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|