Edit |   |
Antigenic Specificity | GVQW1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 30%, rat 33%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human GVQW1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS |
Other Names | GVQW motif containing 1, bA205M20.5, TIGD1L2 |
Gene, Accession # | Gene ID: None, UniProt: Q8N7I0, ENSG00000241043 |
Catalog # | HPA074576 |
Price | |
Order / More Info | GVQW1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |