| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RanBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids. |
|---|
| Other Names | E3 SUMO-protein ligase RanBP2;6.3.2.-;358 kDa nucleoporin;Nuclear pore complex protein Nup358;Nucleoporin Nup358;Ran-binding protein 2;RanBP2;p270;RANBP2;NUP358; |
|---|
| Gene, Accession # | RANBP2, UniProt: P49792 |
|---|
| Catalog # | A00981 |
|---|
| Price | |
|---|
| Order / More Info | RanBP2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|