| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nucleoporin NUP85/Pericentrin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nucleoporin NUP85/Pericentrin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nucleoporin NUP85/Pericentrin 1. This antibody reacts with human. The Nucleoporin NUP85/Pericentrin 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Nucleoporin NUP85/Pericentrin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFL |
|---|
| Other Names | 85 kDa nucleoporin, FLJ12549, frount, nuclear pore complex protein Nup85, nucleoporin 85kDa, Nucleoporin Nup75, Nucleoporin Nup85, Nup75, PCNT, PCNT1, Pericentrin-1 |
|---|
| Gene, Accession # | NUP85, Gene ID: 79902, Accession: Q9BW27, SwissProt: Q9BW27 |
|---|
| Catalog # | NBP2-31860 |
|---|
| Price | |
|---|
| Order / More Info | Nucleoporin NUP85/Pericentrin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|