| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTPN22 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PTPN22 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | tyrosine-protein phosphatase non-receptor type 22 isoform 3; Tyrosine-protein phosphatase non-receptor type 22; tyrosine-protein phosphatase non-receptor type 22; protein tyrosine phosphatase, non-receptor type 22; Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; Lymphoid phosphatase; LyP; PEST-domain phosphatase; PEP, PTPN22; PTPN22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN8; LyP; PEP |
|---|
| Gene, Accession # | PTPN22, Gene ID: 26191, NCBI: NP_001180360.1, UniProt: Q9Y2R2 |
|---|
| Catalog # | MBS177807 |
|---|
| Price | |
|---|
| Order / More Info | PTPN22 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Cohen S, Dadi H, Shaoul E, Sharfe N, Roifman CM (March 1999). Cloning and characterization of a lymphoid-specific, inducible human protein tyrosine phosphatase, Lyp. Blood 93 (6): 2013-24. 2. Cloutier JF, Veillette A (September 1996).Association of inhibitory tyrosine protein kinase p50csk with protein tyrosine phosphatase PEP in T cells and other hemopoietic cells. EMBO J. 15(18): 4909-18. 3. Matthews RJ, Bowne DB, Flores E, Thomas ML (May 1992). Characterization of hematopoietic intrac |
|---|
| 产品资料 |
|
|