Edit |   |
Antigenic Specificity | ADORA2A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 52%, rat 44%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ADORA2A polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
Other Names | adenosine A2a receptor, ADORA2, RDC8 |
Gene, Accession # | Gene ID: 135, UniProt: P29274, ENSG00000128271 |
Catalog # | HPA075997 |
Price | |
Order / More Info | ADORA2A Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |