| Edit |   |
|---|
| Antigenic Specificity | CCBL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CCBL2 antibody. Specificity: CCBL2 antibody was raised against the C terminal of CCBL2 |
|---|
| Immunogen | CCBL2 antibody was raised using the C terminal of CCBL2 corresponding to a region with amino acids LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS |
|---|
| Other Names | CCBL2 protein; Kynurenine--oxoglutarate transaminase 3; kynurenine--oxoglutarate transaminase 3; cysteine conjugate-beta lyase 2; Cysteine-S-conjugate beta-lyase 2 (EC:4.4.1.13); Kynurenine aminotransferase III; KATIII; Kynurenine--glyoxylate transaminase (EC:2.6.1.63); Kynurenine--oxoglutarate transaminase III, CCBL2; CCBL2; KAT3; KATIII; KAT3; KATIII |
|---|
| Gene, Accession # | CCBL2, Gene ID: 56267, NCBI: AAH00819.1 |
|---|
| Catalog # | MBS839854 |
|---|
| Price | |
|---|
| Order / More Info | CCBL2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|