| Edit |   |
| Antigenic Specificity | Hepatitis B Virus |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | n/a |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-Hepatitis B Virus Picoband Antibody. Reactivity: Human Predicted Reactivity: Hepatitis Virus No cross reactivity with other proteins |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ). |
| Other Names | Large S protein; Large S protein, S |
| Gene, Accession # | UniProt: D2X4M3 |
| Catalog # | MBS1750954 |
| Price | |
| Order / More Info | Hepatitis B Virus Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |