Edit |   |
Antigenic Specificity | NEURL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 94%, rat 95%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human NEURL1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVD |
Other Names | neuralized E3 ubiquitin protein ligase 1, h-neu, neu-1, NEURL, RNF67 |
Gene, Accession # | Gene ID: 9148, UniProt: O76050, ENSG00000107954 |
Catalog # | HPA044204 |
Price | |
Order / More Info | NEURL1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |