| Edit |   |
|---|
| Antigenic Specificity | BRWD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | BRWD1 antibody. Specificity: BRWD1 antibody was raised against the N terminal of BRWD1 |
|---|
| Immunogen | BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK |
|---|
| Other Names | BRWD1; BRWD1; C21orf107; FLJ43918; Bromodomain And Wd Repeat Domain Containing 1; WDR9; N143, |
|---|
| Gene, Accession # | BRWD1 |
|---|
| Catalog # | MBS5301933 |
|---|
| Price | |
|---|
| Order / More Info | BRWD1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|