| Edit |   |
|---|
| Antigenic Specificity | Mucolipin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mucolipin 1 antibody. Specificity: Mucolipin 1 antibody was raised against the N terminal of MCOLN1 |
|---|
| Immunogen | Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
|---|
| Other Names | mucolipin 1; Mucolipin-1; mucolipin-1; mucolipin 1; MG-2; Mucolipidin, MCOLN1; MCOLN1; ML4; MG-2; MLIV; MST080; TRPML1; MSTP080; TRP-ML1; TRPM-L1; ML4 |
|---|
| Gene, Accession # | Gene ID: 57192, NCBI: AAG42242.1 |
|---|
| Catalog # | MBS5302916 |
|---|
| Price | |
|---|
| Order / More Info | Mucolipin 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|