| Edit |   |
|---|
| Antigenic Specificity | TFPI2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunoaffinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | IHC WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Recognizes human TFPI2. Species Crossreactivity: mouse |
|---|
| Immunogen | Synthetic peptide corresponding to aa70-105, EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ from human TFPI2 at N-terminal. |
|---|
| Other Names | Tissue factor pathway inhibitor 2;TFPI-2;Placental protein 5;PP5;TFPI2; |
|---|
| Gene, Accession # | TFPI2, Gene ID: 7980, SwissProt: P48307 |
|---|
| Catalog # | 377619 |
|---|
| Price | |
|---|
| Order / More Info | TFPI2 Antibody from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|