| Edit |   |
|---|
| Antigenic Specificity | NR1H4/Fxr |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-NR1H4/Fxr Picoband Antibody. Reactivity: Human, Mouse No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4 (442-486aa QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ), identical to the related mouse and rat sequences.Subcellular Localization: Nucleus.Tissue Specificity: Liver and hepatocyte-related cells express mainly FXRal |
|---|
| Other Names | bile acid receptor isoform 1; Bile acid receptor; bile acid receptor; nuclear receptor subfamily 1 group H member 4; Farnesoid X-activated receptor; Farnesol receptor HRR-1; Nuclear receptor subfamily 1 group H member 4; Retinoid X receptor-interacting protein 14; RXR-interacting protein 14, NR1H4; NR1H4; BAR; FXR; HRR1; HRR-1; PFIC5; RIP14; BAR; FXR; HRR1; RIP14; RXR-interacting protein 14 |
|---|
| Gene, Accession # | NR1H4, Gene ID: 9971, NCBI: NP_001193906.1, UniProt: Q96RI1 |
|---|
| Catalog # | MBS1750491 |
|---|
| Price | |
|---|
| Order / More Info | NR1H4/Fxr Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|