| Edit |   |
| Antigenic Specificity | Carboxyl Ester Lipase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Carboxyl Ester Lipase antibody |
| Immunogen | Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR |
| Other Names | carboxyl ester lipase; Bile salt-activated lipase; bile salt-activated lipase; carboxyl ester lipase; Bile salt-stimulated lipase; BSSL; Bucelipase; Carboxyl ester lipase; Cholesterol esterase; Pancreatic lysophospholipase; Sterol esterase, CEL; CEL; BAL; FAP; BSDL; BSSL; CELL; FAPP; LIPA; CEase; MODY8; BAL; BAL; BSSL |
| Gene, Accession # | Gene ID: 1056, NCBI: AAA51973.1 |
| Catalog # | MBS5302462 |
| Price | |
| Order / More Info | Carboxyl Ester Lipase Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |