| Edit |   |
|---|
| Antigenic Specificity | Carboxylesterase 7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Carboxylesterase 7 antibody. Specificity: Carboxylesterase 7 antibody was raised against the N terminal of CES7 |
|---|
| Immunogen | Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP |
|---|
| Other Names | Carboxylesterase 7; Carboxylesterase 5A; carboxylesterase 5A; carboxylesterase 5A; Carboxylesterase-like urinary excreted protein homolog; Cauxin, CES5A; CES5A; CES5; CES7; CAUXIN; CES4C1; HEL126; CES7; Cauxin |
|---|
| Gene, Accession # | Gene ID: 221223, NCBI: AAH69548.1 |
|---|
| Catalog # | MBS5300142 |
|---|
| Price | |
|---|
| Order / More Info | Carboxylesterase 7 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|