| Edit |   |
|---|
| Antigenic Specificity | IL22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-IL22 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human IL22 (DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA).Subcellular Localization: Secreted. |
|---|
| Other Names | interleukin-22; Interleukin-22; interleukin-22; interleukin 22; Cytokine Zcyto18; IL-10-related T-cell-derived-inducible factor; IL-TIF, IL22; IL22; TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23; ILTIF; ZCYTO18; IL-22; IL-TIF |
|---|
| Gene, Accession # | IL22, Gene ID: 50616, NCBI: NP_065386.1, UniProt: Q9GZX6 |
|---|
| Catalog # | MBS1750524 |
|---|
| Price | |
|---|
| Order / More Info | IL22 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|