| Edit |   |
|---|
| Antigenic Specificity | APH1a |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-APH1a Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | gamma-secretase subunit APH-1A isoform 1; Gamma-secretase subunit APH-1A; gamma-secretase subunit APH-1A; aph-1 homolog A, gamma secretase subunit; Aph-1alpha; Presenilin-stabilization factor, APH1A; APH1A; APH-1; APH-1A; CGI-78; 6530402N02Rik; PSF; APH-1a |
|---|
| Gene, Accession # | APH1A, Gene ID: 51107, NCBI: NP_001071096.1, UniProt: Q96BI3 |
|---|
| Catalog # | MBS178259 |
|---|
| Price | |
|---|
| Order / More Info | APH1a Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Qin W; Jia L; Zhou A; Zuo X; Cheng Z; Wang F; Shi F; Jia J: The -980C/G polymorphism in APH-1A promoter confers risk of Alzheimer's disease. Aging Cell, 2011 Aug. |
|---|