| Edit |   |
|---|
| Antigenic Specificity | RDH12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RDH12 antibody |
|---|
| Immunogen | RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT |
|---|
| Other Names | retinol dehydrogenase 12; Retinol dehydrogenase 12; retinol dehydrogenase 12; retinol dehydrogenase 12 (all-trans/9-cis/11-cis); All-trans and 9-cis retinol dehydrogenase; Short chain dehydrogenase/reductase family 7C member 2, RDH12; RDH12; LCA3; RP53; LCA13; SDR7C2; SDR7C2 |
|---|
| Gene, Accession # | RDH12, Gene ID: 145226, NCBI: NP_689656.2 |
|---|
| Catalog # | MBS5301566 |
|---|
| Price | |
|---|
| Order / More Info | RDH12 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|