| Edit |   |
|---|
| Antigenic Specificity | RDHE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RDHE2 antibody. Specificity: RDHE2 antibody was raised against the middle region of RDHE2 |
|---|
| Immunogen | RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT |
|---|
| Other Names | RDHE2; RDHE2; RDHE2; RDHE 2; RDH-E2; Epidermal Retinal Dehydrogenase 2; RDH#2; RDHE-2; FLJ33105, |
|---|
| Gene, Accession # | RDHE2 |
|---|
| Catalog # | MBS5301654 |
|---|
| Price | |
|---|
| Order / More Info | RDHE2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|