Edit |   |
Antigenic Specificity | JUN |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 97%, rat 95%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human JUN polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
Other Names | jun proto-oncogene, AP-1, c-Jun |
Gene, Accession # | Gene ID: 3725, UniProt: P05412, ENSG00000177606 |
Catalog # | HPA059474 |
Price | |
Order / More Info | JUN Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |