| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EPHX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-EPHX2 Antibody. Specificity: No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids. |
|---|
| Other Names | bifunctional epoxide hydrolase 2 isoform b; Bifunctional epoxide hydrolase 2; bifunctional epoxide hydrolase 2; epoxide hydrolase 2; Cytosolic epoxide hydrolase 2 (EC:3.3.2.10); CEHAlternative name(s):Epoxide hydratase; Soluble epoxide hydrolase; SEH, EPHX2; EPHX2; CEH; SEH; CEH; SEH |
|---|
| Gene, Accession # | EPHX2, Gene ID: 2053, NCBI: NP_001243411.1, UniProt: P34913 |
|---|
| Catalog # | MBS178659 |
|---|
| Price | |
|---|
| Order / More Info | EPHX2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: Epoxide hydrolase 2, cytoplasmic. 2. Morisseau C, Hammock BD (2013). Impact of soluble epoxide hydrolase and epoxyeicosanoids on human health.Annu. Rev. Pharmacol. Toxicol. 53: 37-58. 3. Lee CR, North KE, Bray MS, Fornage M, Seubert JM, Newman JW, Hammock BD, Couper DJ, Heiss G, Zeldin DC (May 2006). Genetic variation in soluble epoxide hydrolase (EPHX2) and risk of coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) study. Hum. Mol. Genet.15 (10): |
|---|
| 产品资料 |
|
|