| Edit |   |
|---|
| Antigenic Specificity | HB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | HB antibody. Specificity: HB antibody was raised against the N terminal Of Hb |
|---|
| Immunogen | HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP |
|---|
| Other Names | HB; HB; Dmel_CG9786; Rg-pbx; CG9786; Hb; hbHLH; Rg-bx, |
|---|
| Gene, Accession # | HB |
|---|
| Catalog # | MBS5303131 |
|---|
| Price | |
|---|
| Order / More Info | HB Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|