| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RRM2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-RRM2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | ribonucleoside-diphosphate reductase subunit M2 isoform 2; Ribonucleoside-diphosphate reductase subunit M2; ribonucleoside-diphosphate reductase subunit M2; ribonucleotide reductase regulatory subunit M2; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit, RRM2; RRM2; R2; RR2; RR2M; RR2 |
|---|
| Gene, Accession # | RRM2, Gene ID: 6241, NCBI: NP_001025.1, UniProt: P31350 |
|---|
| Catalog # | MBS178106 |
|---|
| Price | |
|---|
| Order / More Info | RRM2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: ribonucleotide reductase M2. 2. Pavloff, N., Rivard, D., Masson, S., Shen, S.-H., Mes-Masson, A.-M. Sequence analysis of the large and small subunits of human ribonucleotide reductase. DNA Seq. 2: 227-234, 1992. 3. Yang-Feng, T. L., Thelander, L., Lewis, W. H., Srinivasan, P. R., Francke, U. Gene localization of the ribonucleotide reductase M2 subunit and of related and co-amplified sequences on human and mouse chromosomes. (Abstract) Am. J. Hum. Genet. 39: A174 only, 1986. |
|---|
| 产品资料 |
|
|