| Edit |   |
|---|
| Antigenic Specificity | RRP9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RRP9 antibody. Specificity: RRP9 antibody was raised against the middle region of RRP9 |
|---|
| Immunogen | RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH |
|---|
| Other Names | RRP9; RRP9; RRP-9; Ssu Processome Component Homolog; RRP 9; RRP9; Rrp9 Small Subunit, |
|---|
| Gene, Accession # | RRP9 |
|---|
| Catalog # | MBS5300854 |
|---|
| Price | |
|---|
| Order / More Info | RRP9 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|