| Edit |   |
|---|
| Antigenic Specificity | RSAD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, dog, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RSAD2 antibody. Specificity: RSAD2 antibody was raised against the C terminal of RSAD2 |
|---|
| Immunogen | RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY |
|---|
| Other Names | radical S-adenosyl methionine domain-containing protein 2; Radical S-adenosyl methionine domain-containing protein 2; radical S-adenosyl methionine domain-containing protein 2; radical S-adenosyl methionine domain containing 2; Cytomegalovirus-induced gene 5 protein; Viperin; Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible, RSAD2; RSAD2; cig5; vig1; cig33; 2510004L01Rik |
|---|
| Gene, Accession # | RSAD2, Gene ID: 91543, NCBI: NP_542388.2 |
|---|
| Catalog # | MBS839885 |
|---|
| Price | |
|---|
| Order / More Info | RSAD2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|