| Edit |   |
|---|
| Antigenic Specificity | Human Bcl-2 DyLight® 550 conjugated |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | DyLight®550 conjugate |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | Flow Cytometry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG Polyclonal Anti-Human Bcl-2 Antibody DyLight® 550 Conjugated, Flow Validated. No cross reactivity with other proteins. Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences. |
|---|
| Other Names | Apoptosis regulator Bcl-2; BCL2 |
|---|
| Gene, Accession # | BCL2, UniProt: P10415 |
|---|
| Catalog # | A00040-Dyl550 |
|---|
| Price | |
|---|
| Order / More Info | Human Bcl-2 DyLight® 550 conjugated Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|