| 产品详情 |
| Edit |   |
|---|
| Product Name | ATAD2A, Recombinant, Human, aa981-1108, His-Tag |
|---|
| Description | Highly Purified (~92%). A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa981-1108 from human Bromodomain ATAD2A, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.2kD AA Sequence: MHHHHHHQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLS SVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELD EDFEQLCEEIQESR Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivi |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | ATAD2A, Recombinant, Human, aa981-1108, His-Tag (ANCCA, ATPase Family AAA Domain-containing Protein 2) |
|---|
| Gene, Accession, CAS # | Accession: NM_014109, SwissProt: Q6PL18 |
|---|
| Catalog # | 298326 |
|---|
| Price | |
|---|
| Order / More Info | ATAD2A, Recombinant, Human, aa981-1108, His-Tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|