| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCG2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human mouse rat |
|---|
| Isotype | n/a |
|---|
| Format | immunoaffinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | IHC WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Recognizes human ABCG2. Species Crossreactivity: mouse and rat |
|---|
| Immunogen | Synthetic peptide corresponding to aa137-168, RENLQFSAALRLATTMTNHEKNERINRVIQEL, from human ABCG2 at N-terminus, different from the related mouse sequence by 5aa, and from the related rat sequence by 8aa. |
|---|
| Other Names | ABCG2 (BCRP, ABC Transporter, ABC15, ABCG 2, ABCG2_HUMAN, ABCP, ATP Binding Cassette Sub Family G (White) Member 2, ATP Binding Cassette Transporter G2, ATP-binding Cassette Sub-family G Member 2, BCRP1, BMDP, Breast Cancer Resistance Protein, CD338, CDw338, CDw338 Antigen, GOUT1, Mitoxantrone Resistance Associated Protein, Mitoxantrone Resistance-associated Protein, MRX, Multi Drug Resistance Efflux Transport ATP Binding Cassette Sub Family G (White) Member 2, MXR, MXR1, Placenta Specific ATP Binding Cassette Transporter, Placenta Specific MDR Protein, Placenta-specific ATP-binding Cassette Transporter, UAQTL1) |
|---|
| Gene, Accession # | SwissProt: Q9UNQ0 |
|---|
| Catalog # | 303089 |
|---|
| Price | |
|---|
| Order / More Info | ABCG2 Antibody from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|