Edit |   |
Antigenic Specificity | PLEKHB2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 95%, rat 94%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PLEKHB2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM |
Other Names | pleckstrin homology domain containing B2, EVT2, FLJ20783 |
Gene, Accession # | Gene ID: 55041, UniProt: Q96CS7, ENSG00000115762 |
Catalog # | HPA075014 |
Price | |
Order / More Info | PLEKHB2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |