| Edit |   |
|---|
| Antigenic Specificity | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) |
|---|
| Clone | 2F6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a, kappa |
|---|
| Format | Protein A/G purified |
|---|
| Size | 0.02 mg , 7 ml , 0.1 mg , 0.1 mg , 0.2 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Flow Cytometry (FC/FACS), Immunofluorescence (IF), Western Blot (WB), Immunohistochemistry (IHC) Formalin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody . Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK |
|---|
| Immunogen | Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
|---|
| Other Names | mitogen-activated protein kinase kinase kinase 1; Mitogen-activated protein kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase 1; MAPK/ERK kinase kinase 1; MEK kinase 1; MEKK 1, MAP3K1; MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1; MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1 |
|---|
| Gene, Accession # | MAP3K1, Gene ID: 4214, NCBI: NP_005912.1, UniProt: Q13233 |
|---|
| Catalog # | MBS439590 |
|---|
| Price | |
|---|
| Order / More Info | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589 |
|---|