| Edit |   |
|---|
| Antigenic Specificity | Eph receptor B1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Eph receptor B1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | ephrin type-B receptor 1; Ephrin type-B receptor 1; ephrin type-B receptor 1; EPH receptor B1; ELK; EPH tyrosine kinase 2; EPH-like kinase 6; EK6; hEK6; Neuronally-expressed EPH-related tyrosine kinase; NET; Tyrosine-protein kinase receptor EPH-2, EPHB1; EPHB1; ELK; NET; Hek6; EPHT2; ELK; EPHT2; HEK6; NET; EK6; hEK6; NET |
|---|
| Gene, Accession # | Gene ID: 2047, NCBI: NP_004432.1, UniProt: P54762 |
|---|
| Catalog # | MBS178383 |
|---|
| Price | |
|---|
| Order / More Info | Eph receptor B1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: EPHB1 EPH receptor B1. 2. Flanagan JG, Vanderhaeghen P (1998). The ephrins and Eph receptors in neural development. Annu. Rev. Neurosci. 21: 309-45. 3. Tang XX, Biegel JA, Nycum LM, Yoshioka A, Brodeur GM, Pleasure DE, Ikegaki N (Aug 1996). cDNA cloning, molecular characterization, and chromosomal localization of NET(EPHT2), a human EPH-related receptor protein-tyrosine kinase gene preferentially expressed in brain.Genomics 29 (2): 426-37. |
|---|