| Edit |   |
|---|
| Antigenic Specificity | Ephrin-B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Ephrin-B1 antibody. Specificity: Ephrin-B1 antibody was raised against the middle region of EFNB1 |
|---|
| Immunogen | Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG |
|---|
| Other Names | ephrin-B1; Ephrin-B1; ephrin-B1; ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2, EFNB1; EFNB1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2; EFL3; EPLG2; LERK2; ELK-L; LERK-2 |
|---|
| Gene, Accession # | Gene ID: 1947, NCBI: NP_004420.1 |
|---|
| Catalog # | MBS839890 |
|---|
| Price | |
|---|
| Order / More Info | Ephrin-B1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|