| Edit |   |
|---|
| Antigenic Specificity | NOP16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 95%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human NOP16 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD |
|---|
| Other Names | NOP16 nucleolar protein, HSPC111, HSPC185, LOC51491 |
|---|
| Gene, Accession # | Gene ID: 51491, UniProt: Q9Y3C1, ENSG00000048162 |
|---|
| Catalog # | HPA058147 |
|---|
| Price | |
|---|
| Order / More Info | NOP16 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|