Edit |   |
Antigenic Specificity | MAZ |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human MAZ polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA |
Other Names | MYC-associated zinc finger protein (purine-binding transcription factor), Pur-1, ZF87, Zif87, ZNF801 |
Gene, Accession # | Gene ID: 4150, UniProt: P56270, ENSG00000103495 |
Catalog # | HPA059495 |
Price | |
Order / More Info | MAZ Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |