| Edit |   |
|---|
| Antigenic Specificity | CIART |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CIART Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIART. This antibody reacts with human. The CIART Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C1orf51The immunogen for this antibody is C1orf51. Peptide sequence GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF. |
|---|
| Other Names | BC017397, chromosome 1 open reading frame 51, FLJ25889, hypothetical protein LOC148523 |
|---|
| Gene, Accession # | C1ORF51, Gene ID: 148523, Accession: NP_653298, SwissProt: NP_653298 |
|---|
| Catalog # | NBP1-79508-20ul |
|---|
| Price | |
|---|
| Order / More Info | CIART Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|