| 产品详情 |
| Edit |   |
| Antigenic Specificity | CIB1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CIB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIB1. This antibody reacts with human. The CIB1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CIB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF |
| Other Names | calcium and integrin binding 1 (calmyrin), Calcium- and integrin-binding protein, calmyrin, CIBcalcium and integrin binding protein, CIBP, DNA-dependent protein kinase interacting protein, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP1, KIPcalcium and integrin binding, protein kinase interacting protein, PRKDCIP, SIP2-28calcium and integrin-binding protein 1, Snk interacting protein 2-28, SNK-interacting protein 2-28 |
| Gene, Accession # | CIB1, Gene ID: 10519 |
| Catalog # | NBP2-58792 |
| Price | |
| Order / More Info | CIB1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|