| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | G6PC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G6PC Antibody from Novus Biologicals is a rabbit polyclonal antibody to G6PC. This antibody reacts with human. The G6PC Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human G6PC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL |
|---|
| Other Names | EC 3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha, G6PT, glucose-6-phosphatase, Glucose-6-phosphatase alpha, glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease), glucose-6-phosphatase, catalytic subunit, GSD1, GSD1a, MGC163350 |
|---|
| Gene, Accession # | G6PC, Gene ID: 2538, Accession: P35575, SwissProt: P35575 |
|---|
| Catalog # | NBP2-31916 |
|---|
| Price | |
|---|
| Order / More Info | G6PC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|