| Edit |   |
|---|
| Antigenic Specificity | HORMAD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HORMAD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HORMAD2. This antibody reacts with human. The HORMAD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HORMAD2(HORMA domain containing 2) The peptide sequence was selected from the middle region of HORMAD2. Peptide sequence YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA. |
|---|
| Other Names | HORMA domain containing 2, HORMA domain-containing protein 2, MGC26710 |
|---|
| Gene, Accession # | HORMAD2, Gene ID: 150280, Accession: Q8N7B1, SwissProt: Q8N7B1 |
|---|
| Catalog # | NBP1-52868 |
|---|
| Price | |
|---|
| Order / More Info | HORMAD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|