| Edit |   |
|---|
| Antigenic Specificity | CACNG3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACNG3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACNG3. This antibody reacts with human. The CACNG3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CACNG3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN |
|---|
| Other Names | calcium channel, voltage-dependent, gamma subunit 3, Neuronal voltage-gated calcium channel gamma-3 subunit, voltage-dependent calcium channel gamma-3 subunit, voltage-gated calcium channel gamma subunit |
|---|
| Gene, Accession # | CACNG3, Gene ID: 10368, Accession: O60359, SwissProt: O60359 |
|---|
| Catalog # | NBP2-31738 |
|---|
| Price | |
|---|
| Order / More Info | CACNG3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|