| 产品详情 |
| Edit |   |
| Antigenic Specificity | CIP29 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CIP29 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIP29. This antibody reacts with human, mouse, rat. The CIP29 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CIP29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGL |
| Other Names | CIP29Hcc-1, cytokine induced protein 29 kDa, Cytokine-induced protein of 29 kDa, HCC1MGC14726, hepatocellular carcinoma 1, HSPC316, Nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29, Proliferation-associated cytokine-inducible protein CIP29, SAP domain containing ribonucleoprotein, SAP domain-containing ribonucleoprotein, THO1 |
| Gene, Accession # | SARNP, Gene ID: 84324 |
| Catalog # | NBP1-91788 |
| Price | |
| Order / More Info | CIP29 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|